PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00013768-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NF-YB
Protein Properties Length: 188aa    MW: 21041.6 Da    PI: 4.3364
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00013768-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB58.61.5e-181180372
                  NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwala 72
                           ++d+ lP a +++i+k++lP + ++++da++++ ec +efi +++se+++ c++e+++ti+++ +l al 
  SMil_00013768-RA_Salv 11 KEDASLPKATMTKIIKEMLPPDVRVARDAQDLLIECCVEFINLISSESNEICNKEDKRTIAPEHVLKALQ 80
                           6899**************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.3E-271081IPR009072Histone-fold
SuperFamilySSF471135.32E-251282IPR009072Histone-fold
PfamPF008084.1E-221479IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.101.5E-5104171IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MEPMDIVGRT KEDASLPKAT MTKIIKEMLP PDVRVARDAQ DLLIECCVEF INLISSESNE  60
ICNKEDKRTI APEHVLKALQ NPKIASGEET EACVNSVFRF ERTSDIVNFW GALGFSEYME  120
DVYAAYEQHR VETIDTMRSG KWSNGAEMTE EEALAEQQRM FAEARARMNG GASAPKQSDP  180
ETEPSANS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B1e-271216512133Transcription Regulator NC2 beta chain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096999.15e-98PREDICTED: protein Dr1 homolog
RefseqXP_011097000.15e-98PREDICTED: protein Dr1 homolog
SwissprotP495921e-85NC2B_ARATH; Protein Dr1 homolog
TrEMBLA0A022RMH62e-94A0A022RMH6_ERYGU; Uncharacterized protein
STRINGPGSC0003DMT4000104368e-89(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38202244
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.49e-89nuclear factor Y, subunit B13